CFAP53 Antibody - N-terminal region : Biotin

CFAP53 Antibody - N-terminal region : Biotin
SKU
AVIARP55454_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC11

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cilia- and flagella-associated protein 53

Protein Size: 514

Purification: Affinity Purified
More Information
SKU AVIARP55454_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55454_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 220136
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×