CFHR2 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CFHR2 might be involved in complement regulation. It can associate with lipoproteins and may play a role in lipid metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CFHR2

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Complement factor H-related protein 2

Protein Size: 243

Purification: Affinity Purified

• SKU: AVIARP54784_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54784_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rabbit
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3080
• Host: Rabbit