CFP Antibody - middle region : FITC

CFP Antibody - middle region : FITC
SKU
AVIARP56382_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CFP is a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedbac

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CFP

Key Reference: Bathum,L., (2006) Mol. Immunol. 43 (5), 473-479

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Properdin

Protein Size: 469

Purification: Affinity Purified
More Information
SKU AVIARP56382_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56382_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5199
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×