Chmp2b Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Chmp2b is involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Chmp2b recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Chmp2b redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery Chmp2b also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Involved in cytokinesis .

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Chmp2b

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 213

Purification: Affinity Purified

• SKU: AVIARP54967_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54967_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 363720
• Host: Rabbit