CHTF18 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CHTF18, CHTF8 (MIM 613202), and DCC1 (DSCC1; MIM 613203) are components of an alternative replication factor C (RFC) (see MIM 600404) complex that loads PCNA (MIM 176740) onto DNA during S phase of the cell cycle (Merkle et al., 2003 [PubMed 12766176]; Bermudez et al., 2003 [PubMed 12930902]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHTF18

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: SLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Chromosome transmission fidelity protein 18 homolog

Protein Size: 975

Purification: Affinity Purified

• SKU: AVIARP57590_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57590_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 63922
• Host: Rabbit