CLUAP1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: CLUAP1 may play a role in cell proliferation or apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLUAP1

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: RIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Clusterin-associated protein 1

Protein Size: 413

Purification: Affinity Purified

• SKU: AVIARP55150_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55150_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23059
• Host: Rabbit