CLUL1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CLUL1

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAES

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Clusterin-like protein 1

Protein Size: 466

Purification: Affinity Purified

• SKU: AVIARP55044_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55044_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Dog (Canine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 27098
• Host: Rabbit