CNOT4 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: CNOT4 has E3 ubiquitin ligase activity. The CCR4-NOT complex functions as general transcription regulation complex.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CNOT4

Key Reference: Winkler,G.S., (2004) J. Mol. Biol. 337 (1), 157-165

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: AGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CCR4-NOT transcription complex subunit 4

Protein Size: 639

Purification: Affinity Purified

Subunit: 4

• SKU: AVIARP57877_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57877_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4850
• Host: Rabbit