CNPY3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PRAT4A is associated with the immature form of TLR4 (MIM 603030) and regulates its cell surface expression (Wakabayashi et al., 2006 [PubMed 16849487]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CNPY3

Molecular Weight: 31

Peptide Sequence: Synthetic peptide located within the following region: MDSMPEPASRCLLLLPLLLLLLLLLPAPELGPSQAGAEENDWVRLPSKCE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein canopy homolog 3

Protein Size: 278

Purification: Affinity Purified

• SKU: AVIARP57944_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57944_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10695
• Host: Rabbit