CNPY3 Antibody - N-terminal region : HRP

CNPY3 Antibody - N-terminal region : HRP
SKU
AVIARP57944_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PRAT4A is associated with the immature form of TLR4 (MIM 603030) and regulates its cell surface expression (Wakabayashi et al., 2006 [PubMed 16849487]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CNPY3

Molecular Weight: 31

Peptide Sequence: Synthetic peptide located within the following region: MDSMPEPASRCLLLLPLLLLLLLLLPAPELGPSQAGAEENDWVRLPSKCE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein canopy homolog 3

Protein Size: 278

Purification: Affinity Purified
More Information
SKU AVIARP57944_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57944_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10695
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×