COG6 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi apparatus. The encoded protein is organized with conserved oligomeric Golgi complex components 5, 7 and 8 into a sub-complex referred to as lobe B. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human COG6

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: ADMATFMVNSLYMMKTTLALFEFTDRRLEMLQFQIEAHLDTLINEQASYV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Conserved oligomeric Golgi complex subunit 6

Protein Size: 615

Purification: Affinity Purified

• SKU: AVIARP57442_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57442_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57511
• Host: Rabbit