COPG2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coa

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COPG2

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coatomer subunit gamma-2

Protein Size: 871

Purification: Affinity Purified

Subunit: gamma-2

• SKU: AVIARP54845_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54845_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 26958
• Host: Rabbit