Cops4 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Rat homolog is a member of the COP9 complex, which may act as a regulator of cell signaling pathways.

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: VNENVSLVISRQLLTDFCTHLPNLPDSTAKEVYHFTLEKVQPRVISFEEQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: COP9 signalosome complex subunit 4

Protein Size: 406

Purification: Affinity Purified

Subunit: 4

• SKU: AVIARP56840_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56840_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 360915
• Host: Rabbit