COTL1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COTL1

Key Reference: Dai,H., (2006) Biochim. Biophys. Acta 1764 (11), 1688-1700

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Coactosin-like protein

Protein Size: 142

Purification: Affinity Purified

• SKU: AVIARP55374_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55374_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23406
• Host: Rabbit