Cpa5 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Cpa5 may have carboxypeptidase activity.

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: PGLSPVDRRTLLFCNFILAVAWGQVNFTGDQVLRVLAKNEKQLSLLRDLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribonuclease P protein subunit p21

Protein Size: 436

Purification: Affinity Purified

• SKU: AVIARP58705_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58705_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 408212
• Host: Rabbit