CPEB3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of CPEB3 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPEB3

Key Reference: Heilig,R., (2006) Science 313 (5794), 1788-1792

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytoplasmic polyadenylation element-binding protein 3

Protein Size: 698

Purification: Affinity Purified

• SKU: AVIARP55103_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55103_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 22849
• Host: Rabbit