Cpne5 Antibody - N-terminal region : Biotin

Cpne5 Antibody - N-terminal region : Biotin
SKU
AVIARP57495_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encodes a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: SLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Copine-5

Protein Size: 593

Purification: Affinity Purified
More Information
SKU AVIARP57495_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57495_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 240058
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×