CRYL1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The uronate cycle functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate in the uronate cycle. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CRYL1

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: CVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lambda-crystallin homolog

Protein Size: 319

Purification: Affinity Purified

• SKU: AVIARP58609_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58609_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51084
• Host: Rabbit
• Conjugate: Conjugated, Biotin