CST1 Antibody - Middle region : Biotin

Conjugation: Biotin

Description of Target: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid.

Immunogen: The immunogen for Anti-CST1 antibody is: synthetic peptide directed towards the Middle region of Human CYTN

Key Reference: N/A

Molecular Weight: 15 kDa

Peptide Sequence: Synthetic peptide located within the following region: AISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 141

Purification: Affinity purified

• SKU: AVIARP59199_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59199_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 1469
• Host: Rabbit
• Conjugate: Conjugated, Biotin