CST9L Antibody - N-terminal region : FITC

CST9L Antibody - N-terminal region : FITC
SKU
AVIARP58697_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to mouse cystatin 9. Based on its testis-specific expression, it is likely to have a role in tissue reorganization during early testis development.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CST9L

Key Reference: N/A

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: ILLIYAWHFHEQRDCDEHNVMARYLPATVEFAVHTFNQQSKDYYAYRLGH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cystatin-9-like

Protein Size: 147

Purification: Affinity purified
More Information
SKU AVIARP58697_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58697_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 128821
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×