CSTB Antibody - N-terminal region : Biotin

CSTB Antibody - N-terminal region : Biotin
SKU
AVIARP59177_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: CSTB is a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in CSTB gene are responsible for the primary defects in patients with progressive myoclonic epilepsy a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CSTB

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: ADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cystatin-B

Protein Size: 98

Purification: Affinity Purified
More Information
SKU AVIARP59177_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59177_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Sheep (Ovine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 1476
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×