CUTC Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al., 1995 [PubMed 7635807]; Li et al., 2005 [PubMed 16182249]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CUTC

Key Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: KLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Copper homeostasis protein cutC homolog

Protein Size: 273

Purification: Affinity Purified

• SKU: AVIARP56790_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56790_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51076
• Host: Rabbit