CXorf26 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CXorf26

Key Reference: Cheng,J., (2005) Science 308 (5725), 1149-1154

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: KFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRIQFFAIEIARNREGYNK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UPF0368 protein Cxorf26

Protein Size: 233

Purification: Affinity Purified

• SKU: AVIARP56931_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56931_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51260
• Host: Rabbit