CXorf67 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC340602

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: RRSLSGSADENPSCGTGSERLAFQSRSGSPDPEVPSRASPPVWHAVRMRA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein CXorf67

Protein Size: 503

Purification: Affinity Purified

• SKU: AVIARP55962_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55962_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 340602
• Host: Rabbit