DAGLB Antibody - middle region : FITC

DAGLB Antibody - middle region : FITC
SKU
AVIARP55430_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: DAGLB belongs to the AB hydrolase superfamily.It catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. This protein is required for axonal growth during development and for retrograde synaptic signaling at mature synapses.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DAGLB

Key Reference: Ma,J., (2007) Atherosclerosis 191 (1), 63-72

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sn1-specific diacylglycerol lipase beta

Protein Size: 672

Purification: Affinity Purified
More Information
SKU AVIARP55430_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55430_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 221955
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×