DAPK1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consen

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DAPK1

Molecular Weight: 157kDa

Peptide Sequence: Synthetic peptide located within the following region: MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Death-associated protein kinase 1

Protein Size: 1431

Purification: Affinity Purified

• SKU: AVIARP58219_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58219_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 1612
• Host: Rabbit