DBNDD2 Antibody - middle region : Biotin

DBNDD2 Antibody - middle region : Biotin
SKU
AVIARP56283_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: DBNDD2 may modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro). .

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human DBNDD2

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: DPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dysbindin domain-containing protein 2

Protein Size: 161

Purification: Affinity Purified
More Information
SKU AVIARP56283_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56283_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55861
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×