Dcdc2a Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the doublecortin family. The protein encoded by this gene contains two doublecortin domains. The doublecortin domain has been demonstrated to bind tubulin and enhance microtubule polymerization.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: QIESGGNYVAGGPEAFKKLNYLDIGEIKKRPMEAVNTEVKPVIHSRINVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 368

Purification: Affinity Purified

• SKU: AVIARP56892_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56892_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 195208
• Host: Rabbit