DCUN1D4 Antibody - middle region : Biotin

DCUN1D4 Antibody - middle region : Biotin
SKU
AVIARP54513_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: DCUN1D4 contains 1 DCUN1 domain. The exact function of DCUN1D4 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DCUN1D4

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DCN1-like protein 4

Protein Size: 292

Purification: Affinity Purified
More Information
SKU AVIARP54513_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54513_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23142
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×