DCUN1D4 Antibody - N-terminal region : HRP

DCUN1D4 Antibody - N-terminal region : HRP
SKU
AVIARP54512_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: DCUN1D4 contains 1 DCUN1 domain. The exact function of DCUN1D4 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCUN1D4

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: TLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKVMPPRKKRRPASGDDLSA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DCN1-like protein 4

Protein Size: 257

Purification: Affinity Purified
More Information
SKU AVIARP54512_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54512_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23142
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×