DDI1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDI1

Key Reference: Puente,X.S. (2004) Genome Res. 14 (4), 609-622

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: KNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein DDI1 homolog 1

Protein Size: 396

Purification: Affinity Purified

• SKU: AVIARP56142_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56142_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 414301
• Host: Rabbit