DEPDC1 Antibody - middle region : Biotin

DEPDC1 Antibody - middle region : Biotin
SKU
AVIARP56317_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of DEPDC1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DEPDC1

Molecular Weight: 89kDa

Peptide Sequence: Synthetic peptide located within the following region: PEPLLTFEYYELFVNILVVCGYITVSDRSSGIHKIQDDPQSSKFLHLNNL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DEP domain-containing protein 1A

Protein Size: 811

Purification: Affinity Purified
More Information
SKU AVIARP56317_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56317_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55635
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×