DHDH Antibody - middle region : Biotin

DHDH Antibody - middle region : Biotin
SKU
AVIARP55066_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: DHDH is an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction.This gene encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DHDH

Key Reference: Aoki,S., Chem. Biol. Interact. 130-132 (1-3), 775-784 (2001)

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: PCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase

Protein Size: 334

Purification: Affinity Purified
More Information
SKU AVIARP55066_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55066_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27294
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×