DMTN Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Dematin, or EPB49, is an actin-bundling protein originally identified in the erythroid membrane skeleton. Its actin-bundling activity is abolished upon phosphorylation by cAMP-dependent protein kinase and is restored after dephosphorylation.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DMTN

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: KGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dematin

Protein Size: 383

Purification: Affinity Purified

• SKU: AVIARP58695_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58695_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2039
• Host: Rabbit