DNAH6 Antibody - middle region : HRP

DNAH6 Antibody - middle region : HRP
SKU
AVIARP55679_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene belongs to the dynein family, whose members encode large proteins that are constituents of the microtubule-associated motor protein complex. This complex is composed of dynein heavy, intermediate and light chains, which can be axonemal or cytoplasmic. This protein is an axonemal dynein heavy chain. It is involved in producing force for ciliary beating by using energy from ATP hydrolysis. Mutations in this gene may cause primary ciliary dyskinesia (PCD) as well as heterotaxy.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human DYH6

Key Reference: N/A

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: QIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: dynein heavy chain 6, axonemal

Protein Size: 408

Purification: Affinity purified
More Information
SKU AVIARP55679_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55679_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 1768
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×