Dnaja1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Dnaja1 is a co-chaperone of Hsc70. Dnaja1 seems to play a role in protein import into mitochondria.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DnaJ homolog subfamily A member 1

Protein Size: 397

Purification: Affinity Purified

• SKU: AVIARP54580_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54580_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 15502
• Host: Rabbit