Dnaja1 Antibody - N-terminal region : HRP

Dnaja1 Antibody - N-terminal region : HRP
SKU
AVIARP54580_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Dnaja1 is a co-chaperone of Hsc70. Dnaja1 seems to play a role in protein import into mitochondria.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DnaJ homolog subfamily A member 1

Protein Size: 397

Purification: Affinity Purified
More Information
SKU AVIARP54580_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54580_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 15502
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×