Dnaja4 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Dnaja4

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: IIEVHVDKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Chaperone protein DnaJ HAMAP-Rule MF_01152

Protein Size: 555

Purification: Affinity Purified

• SKU: AVIARP57275_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57275_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 300721
• Host: Rabbit