DNAJA4 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human DNAJA4

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: EKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: dnaJ homolog subfamily A member 4

Protein Size: 181

Purification: Affinity Purified

• SKU: AVIARP57276_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57276_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55466
• Host: Rabbit