DNAJB1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: DNAJB1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DNAJB1

Key Reference: Cheng,X., (2008) J. Virol. 82 (3), 1229-1237

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DnaJ homolog subfamily B member 1

Protein Size: 340

Purification: Affinity Purified

• SKU: AVIARP54795_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54795_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 3337
• Host: Rabbit