DNAJC12 Antibody - middle region : FITC

DNAJC12 Antibody - middle region : FITC
SKU
AVIARP57556_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DNAJC12

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DnaJ homolog subfamily C member 12

Protein Size: 198

Purification: Affinity Purified
More Information
SKU AVIARP57556_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57556_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56521
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×