DNAJC12 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DNAJC12

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DnaJ homolog subfamily C member 12

Protein Size: 198

Purification: Affinity Purified

• SKU: AVIARP57556_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57556_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 56521
• Host: Rabbit