DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DG1/447 & DOG-1.1 (Concentrate)

DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DG1/447 & DOG-1.1 (Concentrate)
SKU
SCYRA0364-C.1
Packaging Unit
0,1 ml
Manufacturer
ScyTek Laboratories

Availability: loading...
Price is loading...
Specificity: This monoclonal antibody recognizes Human DOG1. It is a sensitive and specific immunohistochemical marker for GIST, comparable with c-Kit, with the additional benefit of detecting c-Kit-negative GISTs. It is also a sensitive marker for unusual GIST subgroups lacking c-Kit or PDGFRA mutations.
Immunogen: Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
More Information
SKU SCYRA0364-C.1
Manufacturer ScyTek Laboratories
Manufacturer SKU RA0364-C.1
Green Labware No
Package Unit 0,1 ml
Quantity Unit STK
Reactivity Human
Clonality Monoclonal
Isotype IgG1
Host Mouse
Product information (PDF) Download
MSDS (PDF) Download