DPPA3 Antibody - N-terminal region : Biotin

DPPA3 Antibody - N-terminal region : Biotin
SKU
AVIARP58824_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein that in mice may function as a maternal factor during the preimplantation stage of development. In mice, this gene may play a role in transcriptional repression, cell division, and maintenance of cell pluripotentiality. In humans, related intronless loci are located on chromosomes 14 and X.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DPPA3

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: DPSQFNPTYIPGSPQMLTEENSRDDSGASQISSETLIKNLSNLTINASSE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Developmental pluripotency-associated protein 3

Protein Size: 159

Purification: Affinity Purified
More Information
SKU AVIARP58824_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58824_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 359787
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×