DPPA4 Antibody - N-terminal region : Biotin

DPPA4 Antibody - N-terminal region : Biotin
SKU
AVIARP57139_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: DPPA4 may play a role in maintaining cell pluripotentiality.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA4

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Developmental pluripotency-associated protein 4

Protein Size: 304

Purification: Affinity Purified
More Information
SKU AVIARP57139_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57139_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55211
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×