DPPA4 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: DPPA4 may play a role in maintaining cell pluripotentiality.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA4

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Developmental pluripotency-associated protein 4

Protein Size: 304

Purification: Affinity Purified

• SKU: AVIARP57139_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57139_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55211
• Host: Rabbit