DPPA5 Antibody - N-terminal region : Biotin

DPPA5 Antibody - N-terminal region : Biotin
SKU
AVIARP58746_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA5

Key Reference: Pierre,A., (2007) Genomics 90 (5), 583-594

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Developmental pluripotency-associated 5 protein

Protein Size: 116

Purification: Affinity Purified
More Information
SKU AVIARP58746_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58746_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 340168
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×