DPPA5 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA5

Key Reference: Pierre,A., (2007) Genomics 90 (5), 583-594

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Developmental pluripotency-associated 5 protein

Protein Size: 116

Purification: Affinity Purified

• SKU: AVIARP58746_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58746_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 340168
• Host: Rabbit
• Conjugate: Conjugated, FITC