DPY19L2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact functions of DPY19L2 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPY19L2

Key Reference: Carson,A.R., (er) BMC Genomics 7, 45 (2006)

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein dpy-19 homolog 2

Protein Size: 758

Purification: Affinity Purified

• SKU: AVIARP55709_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55709_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 283417
• Host: Rabbit