DPY19L4 Antibody - middle region : FITC

DPY19L4 Antibody - middle region : FITC
SKU
AVIARP55806_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPY19L4

Key Reference: Tsuritani,K., (2007) Genome Res. 17 (7), 1005-1014

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein dpy-19 homolog 4

Protein Size: 723

Purification: Affinity Purified
More Information
SKU AVIARP55806_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55806_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 286148
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×